P6165 Osm

Search for all "Osm"

10 µg / €290.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Osm

P6165

Product Description for Osm

Osm.

Properties for Osm

Product Category Proteins & Growth Factors
Quantity 10 µg
Synonyms -
Species (Protein) Rat
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q65Z15
Add. information Escherichia coli
Application Func, SDS-PAGE
Storage Store at -20°C.
Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
Description
AA Sequence:
MKRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHAT LGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKI DSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRRHSPLWAWLKGDHRIRPSRSSQSAMLRSLVPR
Format
Buffer System:
Lyophilized from solutions contain no sodiun azide nor carrier protein.
State:
Lyophilized
  • LinkedIn