discontinued

H00004982-H01 Osteoprotegerin / TNFRSF11B

Search for all "Osteoprotegerin / TNFRSF11B"

Quick Overview

Osteoprotegerin / TNFRSF11B

H00004982-H01

Product Description for Osteoprotegerin / TNFRSF11B

Osteoprotegerin / TNFRSF11B.

Properties for Osteoprotegerin / TNFRSF11B

Product Category Proteins & Growth Factors
Target Category
Quantity 25 µg
Synonyms OCIF, OPG, Osteoclastogenesis inhibitory factor, Tumor necrosis factor receptor superfamily member 11B
Source Human HEK293T cells
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O00300
Add. information SDS-PAGE and Western Blot
Human
Application WB, ELISA, SDS-PAGE, PI
Concentration 10.0 ug/ml
Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
FPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNR THNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQ KGNATHDNICSGNSESTQK
Format
Buffer System:
100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
State:
Liquid
  • LinkedIn