discontinued

P6124 Osteoprotegerin / TNFRSF11B

Search for all "Osteoprotegerin / TNFRSF11B"

Quick Overview

Osteoprotegerin / TNFRSF11B

P6124

Product Description for Osteoprotegerin / TNFRSF11B

Osteoprotegerin / TNFRSF11B.

Properties for Osteoprotegerin / TNFRSF11B

Product Category Proteins & Growth Factors
Target Category
Quantity 50 µg
Synonyms OCIF, OPG, Osteoclastogenesis inhibitory factor, Tumor necrosis factor receptor superfamily member 11B
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O00300
Add. information Escherichia coli
Application Func, SDS-PAGE
Storage Store at -20°C.
Reconstitute in 5 mM Tris, pH 7.5 to a concentration of 0.1-1.0 mg/mL. Do not vortex.
For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
Description
AA Sequence:
METFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQE CNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLL LTQKGNATHDNICSGNSESTQK
Format
Buffer System:
Lyophilized from 10 mM Tris (pH 7.5, 75 mM NaCl).
State:
Lyophilized
  • LinkedIn