discontinued

P3430 OSTN

Search for all "OSTN"

Quick Overview

OSTN

P3430

Product Description for OSTN

OSTN.

Properties for OSTN

Product Category Proteins & Growth Factors
Quantity 10 µg
Synonyms MUSCLIN
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P61366
Add. information Loading 3 ug protein in 15% SDS-PAGE
Escherichia coli
Application SDS-PAGE
Concentration 0.5 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMVDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKR SFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG
Format
Buffer System:
In 20 mM Tris-HCl, 200 mM NaCl, pH 8.0 (2 mM dithiothreitol, 20% glycerol).
State:
Liquid
  • LinkedIn