P3430 OSTN

Search for all "OSTN"

10 µg / €380.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

OSTN

P3430

Product Description for OSTN

OSTN.

Properties for OSTN

Product Category Proteins & Growth Factors
Quantity 10 µg
Synonyms MUSCLIN
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P61366
Add. information Loading 3 ug protein in 15% SDS-PAGE
Escherichia coli
Application SDS-PAGE
Concentration 0.5 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMVDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKR SFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG
Format
Buffer System:
In 20 mM Tris-HCl, 200 mM NaCl, pH 8.0 (2 mM dithiothreitol, 20% glycerol).
State:
Liquid
  • LinkedIn