AR31127PU-S OXM (1-37)

Search for all "OXM (1-37)"

0.1 mg / €200.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

OXM (1-37)

AR31127PU-S

Product Description for OXM (1-37)

OXM (1-37).

Properties for OXM (1-37)

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Molecular weight 4450.07 Da
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Acris Antibodies GmbH
Material safety datasheet MSDS for Proteins (de)

Datasheet Extract

Purity > 95 % by HPLC
Storage Upon receipt, store undiluted (in aliquots) at -20°C.
Avoid repeated freezing and thawing.
Shelf life: One year from despatch.
Description
Description:
OXM(1-37) Peptide.
AA Sequence:
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH
Format
Purity:
>95% by HPLC
State:
Purified peptide
  • LinkedIn