discontinued

P4912 p24

Search for all "p24"

Quick Overview

p24

P4912

Product Description for p24

p24.

Properties for p24

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P12493
Add. information 15% SDS-PAGE Stained with Coomassie Blue
Escherichia coli
Application SDS-PAGE
Concentration 0.5 mg/mL
Storage Store at -20°C. For long term storage store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEA AEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDI RQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETL
Format
Buffer System:
In 20 mM Tris-HCl, 100 mM NaCl, pH 8.0 (0.1 mM PMSF, 10% glycerol).
State:
Liquid
  • LinkedIn