P4912 p24

Search for all "p24"

0.1 mg / €450.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

p24

P4912

Product Description for p24

p24.

Properties for p24

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P12493
Add. information 15% SDS-PAGE Stained with Coomassie Blue
Escherichia coli
Application SDS-PAGE
Concentration 0.5 mg/mL
Storage Store at -20°C. For long term storage store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEA AEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDI RQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETL
Format
Buffer System:
In 20 mM Tris-HCl, 100 mM NaCl, pH 8.0 (0.1 mM PMSF, 10% glycerol).
State:
Liquid
  • LinkedIn