discontinued

P3473 PPIL1

Search for all "PPIL1"

Quick Overview

PPIL1

P3473

Product Description for PPIL1

PPIL1.

Properties for PPIL1

Product Category Proteins & Growth Factors
Target Category
Quantity 0.1 mg
Synonyms CYPL1, PPIase, Peptidyl-prolyl cis-trans isomerase-like 1, Rotamase PPIL1
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y3C6
Add. information Loading 3 ug protein in 15% SDS-PAGE
Escherichia coli
Application Func, SDS-PAGE
Concentration 1.0 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGAS IYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDR PVDDVKIIKAYPSGLEHHHHHH
Format
Buffer System:
In 20 mM Tris-HCl, pH 8.0 (20% glycerol).
State:
Liquid
  • LinkedIn