discontinued

AR10238PU-L PramLintide

Search for all "PramLintide"

25 mg / €570.00

Quick Overview

PramLintide

AR10238PU-L

Product Description for PramLintide

PramLintide.
Presentation: Purified

Properties for PramLintide

Product Category Proteins & Growth Factors
Quantity 25 mg
Presentation Purified
Molecular weight 3949.4 Da
Source Synthetic
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Acris Antibodies GmbH
Material safety datasheet MSDS for Proteins (de)

Datasheet Extract

Purity > 98.0% as determined both RP-HPLC and SDS-PAGE analysis
Background

Pramlintide acetate is a hormone that is released into the bloodstream, in a similar pattern as insulin. Pramlintide aids in the absorption of glucose by slowing gastric emptying, promoting satiety, and inhibiting inappropriate secretion of glucagon, a catabolic hormone that opposes the effects of insulin.

Storage

Prior to reconstitution store at 2-8°C for one month or desiccated below -18°C.
Following reconstitution store undiluted at 2-8°C for one month or (in aliquots) at -20°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.

Source Synthetic
Description
Description:
Pramlintide Synthetic is a single, non-glycosylated polypeptide chain containing 37 amino acids. 
Molecular formula: C171H267N51O53S
Amino Acid Composition: KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2
Format
Purity:
> 98.0% as determined both RP-HPLC and SDS-PAGE analysis
State:
Sterile Filtered White lyophilized (freeze-dried) powder without additives
Purified
Reconstitution:
Restore in sterile 18MΩ-cm-1 H2o not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
The Pramlintide is also soluble in 1% Acetic Acid.
  • LinkedIn