discontinued

AR10238PU-N PramLintide

Search for all "PramLintide"

5 mg / €300.00

Quick Overview

PramLintide

AR10238PU-N

Product Description for PramLintide

PramLintide.
Presentation: Purified

Properties for PramLintide

Product Category Proteins & Growth Factors
Quantity 5 mg
Presentation Purified
Molecular weight 3949.4 Da
Source Synthetic
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Acris Antibodies GmbH
Material safety datasheet MSDS for Proteins (de)

Datasheet Extract

Purity > 98.0% as determined both RP-HPLC and SDS-PAGE analysis
Background

Pramlintide acetate is a hormone that is released into the bloodstream, in a similar pattern as insulin. Pramlintide aids in the absorption of glucose by slowing gastric emptying, promoting satiety, and inhibiting inappropriate secretion of glucagon, a catabolic hormone that opposes the effects of insulin.

Storage

Prior to reconstitution store at 2-8°C for one month or desiccated below -18°C.
Following reconstitution store undiluted at 2-8°C for one month or (in aliquots) at -20°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.

Source Synthetic
Description
Description:
Pramlintide Synthetic is a single, non-glycosylated polypeptide chain containing 37 amino acids. 
Molecular formula: C171H267N51O53S
Amino Acid Composition: KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2
Format
Purity:
> 98.0% as determined both RP-HPLC and SDS-PAGE analysis
State:
Sterile Filtered White lyophilized (freeze-dried) powder without additives
Purified
Reconstitution:
Restore in sterile 18MΩ-cm-1 H2o not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
The Pramlintide is also soluble in 1% Acetic Acid.
  • LinkedIn