AR31125PU-L (Pro3) Gastric inhibitory polypeptide

Search for all "(Pro3) Gastric inhibitory polypeptide"

1.0 mg / €640.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

(Pro3) Gastric inhibitory polypeptide

AR31125PU-L

Product Description for (Pro3) Gastric inhibitory polypeptide

(Pro3) Gastric inhibitory polypeptide.

Properties for (Pro3) Gastric inhibitory polypeptide

Product Category Proteins & Growth Factors
Target Category
Quantity 1.0 mg
Synonyms GIP, Glucose-dependent insulinotropic polypeptide
Molecular weight 4951.57 Da
Species (Protein) Human
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Proteins (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
P09681
Purity > 95 % by HPLC
Application Bioactivity
Background The gastric inhibitory peptide (GIP) is a potent stimulator of insulin secretion and poor inhibitor of gastric acid secretion.
Storage Upon receipt, store undiluted (in aliquots) at -20°C.
Avoid repeated freezing and thawing.
Shelf life: One year from despatch.
Description
Description:
Human (Pro3) Gastric Inhibitory Peptide (GIP).
Formula: C226H338N60O66S
AA Sequence:
YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH (1-letter code).
Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH (3-letter code).
Format
Purity:
>95% by HPLC
State:
Purified peptide
  • LinkedIn