P4325 PSMG4

Search for all "PSMG4"

0.1 mg / €380.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

PSMG4

P4325

Product Description for PSMG4

PSMG4.

Properties for PSMG4

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms C6orf86, PAC4, bA506K6.2
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5JS54
Add. information 15% SDS-PAGE Stained with Coomassie Blue
Escherichia coli
Application SDS-PAGE
Concentration 0.5 mg/mL
Storage Store at -20°C. For long term storage store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMEGLVVAAGGDVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCS RYDSIPVSTSLLGDTSDTTSTGLAQRLARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF
Format
Buffer System:
In 20 mM Tris-HCl, 0.1 M NaCl, pH 8.0. (10% glycerol, 1 mM DTT).
State:
Liquid
  • LinkedIn