discontinued

P4325 PSMG4

Search for all "PSMG4"

Quick Overview

PSMG4

P4325

Product Description for PSMG4

PSMG4.

Properties for PSMG4

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms C6orf86, PAC4, bA506K6.2
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5JS54
Add. information 15% SDS-PAGE Stained with Coomassie Blue
Escherichia coli
Application SDS-PAGE
Concentration 0.5 mg/mL
Storage Store at -20°C. For long term storage store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMEGLVVAAGGDVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCS RYDSIPVSTSLLGDTSDTTSTGLAQRLARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF
Format
Buffer System:
In 20 mM Tris-HCl, 0.1 M NaCl, pH 8.0. (10% glycerol, 1 mM DTT).
State:
Liquid
  • LinkedIn