discontinued

P5185 SAA1

Search for all "SAA1"

Quick Overview

SAA1

P5185

Product Description for SAA1

SAA1.

Properties for SAA1

Product Category Proteins & Growth Factors
Quantity 10 µg
Synonyms -
Species (Protein) Monkey
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P02738
Add. information Escherichia coli
Application Func, SDS-PAGE
Storage Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
RSWFSFLGEAYDGARDMWRAYSDMKEANYKNSDKYFHARGNYDAAQRGPGGVWAAEVISDARENIQKLLGRGAEDT LADQAANEWGRSGKDPNHFRPAGLPEKY
Format
Buffer System:
Lyophilized from PBS pH 7.4.
State:
Lyophilized
  • LinkedIn