P5946 SAA1

Search for all "SAA1"

50 µg / €330.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

SAA1

P5946

Product Description for SAA1

SAA1.

Properties for SAA1

Product Category Proteins & Growth Factors
Quantity 50 µg
Synonyms MGC111216, PIG4, SAA, TP53I4
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P0DJI8
Add. information Escherichia coli
Application Func, SDS-PAGE
Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAED SLADQAANEWGRSGKDPNHFRPAGLPEKY
Format
Buffer System:
Lyophilized from solutions contain no sodiun azide nor carrier protein.
State:
Lyophilized
  • LinkedIn