discontinued

P5946 SAA1

Search for all "SAA1"

Quick Overview

SAA1

P5946

Product Description for SAA1

SAA1.

Properties for SAA1

Product Category Proteins & Growth Factors
Quantity 50 µg
Synonyms MGC111216, PIG4, SAA, TP53I4
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P0DJI8
Add. information Escherichia coli
Application Func, SDS-PAGE
Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAED SLADQAANEWGRSGKDPNHFRPAGLPEKY
Format
Buffer System:
Lyophilized from solutions contain no sodiun azide nor carrier protein.
State:
Lyophilized
  • LinkedIn