discontinued

H00006289-P02-25 Serum Amyloid A protein (SAA)

Search for all "Serum Amyloid A protein (SAA)"

Quick Overview

Serum Amyloid A protein (SAA)

H00006289-P02-25

Product Description for Serum Amyloid A protein (SAA)

Serum Amyloid A protein (SAA).

Properties for Serum Amyloid A protein (SAA)

Product Category Proteins & Growth Factors
Target Category
Quantity 25 µg
Synonyms SAA1, SAA2
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P02735
Add. information 12.5% SDS-PAGE Stained with Coomassie Blue
Wheat Germ (in vitro)
Application AP, Array, ELISA, WB-Re
Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Best use within three months from the date of receipt of this protein.
Description
AA Sequence:
RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGRGAEDS LADQAANKWGRSGRDPNHFRPAGLPEKY
Format
Buffer System:
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • LinkedIn