P5868 SH3BGRL2

Search for all "SH3BGRL2"

0.1 mg / €450.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

SH3BGRL2

P5868

Product Description for SH3BGRL2

SH3BGRL2.

Properties for SH3BGRL2

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms FLJ90025
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UJC5
Add. information 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Escherichia coli
Application SDS-PAGE
Concentration 0.5 mg/mL
Storage Store at -20°C. For long term storage store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMGSMVIRVFIASSSGFVAIKKKQQDVVRFLEANKIEFEEVDITMSEEQRQWMYKNV PPEKKPTQGNPLPPQIFNGDRYCGDYDSFFESKESNTVFSFLGLKPRLASKAEP
Format
State:
Liquid
  • LinkedIn