discontinued

H00010571-Q01-25 SMA3

Search for all "SMA3"

25 µg / €510.00

Quick Overview

SMA3

H00010571-Q01-25

Product Description for SMA3

SMA3.

Properties for SMA3

Product Category Proteins & Growth Factors
Quantity 25 µg
Synonyms SMA3 - SMA3, b55C20.2
Source in vitro transl.
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
AGTQGQLKVLGANLWWPYLMHEHPAYLYSWEDGDCSHQSLGPLPACDLCDQLHLRSRQGGSVCGCDPCEQLLLLVS QLRAPGVDSAAAGRPV*
Format
Buffer System:
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • LinkedIn