discontinued

P3436 SNTN

Search for all "SNTN"

Quick Overview

SNTN

P3436

Product Description for SNTN

SNTN.

Properties for SNTN

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms FLJ44379, sentan
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NMZ2
Add. information Loading 3 ug protein in 15% SDS-PAGE
Escherichia coli
Application SDS-PAGE
Concentration 0.5 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMGGCMHSTQDKSLHLEGDPNPSAAPTSTCAPRKMPKRISISKQLASVKALRKCSDL EKAIATTALIFRNSSDSDGKLEKAIAKDLLQTQFRNFAEGQETKPKYREILSELDEHTENKLDFEDFMILLLSITV MSDLLQNIRNVKIMK
Format
Buffer System:
In 20 mM Tris-HCl, 0.15M NaCl, pH 8.0 (1 mM dithiothreitol, 50% glycerol).
State:
Liquid
  • LinkedIn