P3436 SNTN

Search for all "SNTN"

0.1 mg / €380.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

SNTN

P3436

Product Description for SNTN

SNTN.

Properties for SNTN

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms FLJ44379, sentan
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NMZ2
Add. information Loading 3 ug protein in 15% SDS-PAGE
Escherichia coli
Application SDS-PAGE
Concentration 0.5 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMGGCMHSTQDKSLHLEGDPNPSAAPTSTCAPRKMPKRISISKQLASVKALRKCSDL EKAIATTALIFRNSSDSDGKLEKAIAKDLLQTQFRNFAEGQETKPKYREILSELDEHTENKLDFEDFMILLLSITV MSDLLQNIRNVKIMK
Format
Buffer System:
In 20 mM Tris-HCl, 0.15M NaCl, pH 8.0 (1 mM dithiothreitol, 50% glycerol).
State:
Liquid
  • LinkedIn