P6015 sspA (Staphylococcus aureus)

Search for all "sspA (Staphylococcus aureus)"

50 µg / €330.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

sspA (Staphylococcus aureus)

P6015

Product Description for sspA (Staphylococcus aureus)

sspA (Staphylococcus aureus).

Properties for sspA (Staphylococcus aureus)

Product Category Proteins & Growth Factors
Quantity 50 µg
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P09332
Add. information Escherichia coli
Application Func, SDS-PAGE
Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
LPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHVVDATHGDPHALKAFPSAINQDNYPNG GFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVVKPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLK GEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDIHFANDDQPNNPDNPDNP NNPDNPNNPDEPNNPDNPNNPDNPDNGDNNNSDNPDAA
Format
Buffer System:
Lyophilized from solutions contain no sodiun azide nor carrier protein.
State:
Lyophilized
  • LinkedIn