discontinued

P3722 SULT1A2

Search for all "SULT1A2"

Quick Overview

SULT1A2

P3722

Product Description for SULT1A2

SULT1A2.

Properties for SULT1A2

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms HAST4, MGC142287, MGC142289, P-PST, ST1A2, STP2, TSPST2
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P50226
Add. information Escherichia coli
Application SDS-PAGE
Concentration 1.0 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQ ILDMIYQGGDLEKCHRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNA KDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKIL EFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKM AGCSLSFRSEL
Format
Buffer System:
In 20 mM Tris-HCl, 100 mM, pH 8.0 (1 mM dithiothreitol, 10% glycerol).
State:
Liquid
  • LinkedIn