P3722 SULT1A2

Search for all "SULT1A2"

0.1 mg / €380.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

SULT1A2

P3722

Product Description for SULT1A2

SULT1A2.

Properties for SULT1A2

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms HAST4, MGC142287, MGC142289, P-PST, ST1A2, STP2, TSPST2
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P50226
Add. information Escherichia coli
Application SDS-PAGE
Concentration 1.0 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQ ILDMIYQGGDLEKCHRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNA KDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKIL EFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKM AGCSLSFRSEL
Format
Buffer System:
In 20 mM Tris-HCl, 100 mM, pH 8.0 (1 mM dithiothreitol, 10% glycerol).
State:
Liquid
  • LinkedIn