discontinued

H00050840-Q01 TAS2R14

Search for all "TAS2R14"

Quick Overview

TAS2R14

H00050840-Q01

Product Description for TAS2R14

TAS2R14.

Properties for TAS2R14

Product Category Proteins & Growth Factors
Target Category
Quantity 2 µg
Synonyms TRB1, Taste receptor T2R14, Taste receptor family B member 1, Taste receptor type 2 member 14
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NYV8
Add. information 12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Application AP, Array, ELISA, WB-Re
Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Best use within three months from the date of receipt of this protein.
Description
AA Sequence:
HINASINGYRRNKTCSSDSSNFTRFSSLIVLTSTVFIFIPFTLSLAMFLLLIFSMWKHRKKMQHTVKISGDASTKA HRGVKSVITFFLLYAIFSLSFFISVWTSERLEEN
Format
Buffer System:
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • LinkedIn