discontinued

P5924 TGFB2

Search for all "TGFB2"

5 µg / €290.00

Quick Overview

TGFB2

P5924

Product Description for TGFB2

TGFB2.

Properties for TGFB2

Product Category Proteins & Growth Factors
Quantity 5 µg
Synonyms MGC116892, TGF-beta2
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P01423
Add. information 0.3 ug/lane in 15% SDS-polyacrylamide gel and stained with Coomassie blue
Plants
Application WB-Re, Func, SDS-PAGE
Storage Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINP EASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Format
Buffer System:
Lyophilized from Tris HCl 0.05M buffer at pH 7.4.
State:
Lyophilized
  • LinkedIn