H00006964-Q01-10 TRD@

Search for all "TRD@"

10 µg / €380.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

TRD@

H00006964-Q01-10

Product Description for TRD@

TRD@.

Properties for TRD@

Product Category Proteins & Growth Factors
Quantity 10 µg
Synonyms TCRD, TCRDV1, TRD
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Add. information 12.5% SDS-PAGE Stained with Coomassie Blue
Wheat Germ (in vitro)
Application AP, Array, ELISA, WB-Re
Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Best use within three months from the date of receipt of this protein.
Description
AA Sequence:
LVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKS CHKPKAIVHTEKVNMMSLTVLGLR
Format
Buffer System:
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • LinkedIn