discontinued

AR10448PU-N Tropic 1808

Search for all "Tropic 1808"

50 µg / €300.00

Quick Overview

Tropic 1808

AR10448PU-N

Product Description for Tropic 1808

Tropic 1808.
Presentation: Purified

Properties for Tropic 1808

Product Category Proteins & Growth Factors
Quantity 50 µg
Presentation Purified
Molecular weight 29.1 kDa
Source E. coli
Species (Protein) Rat
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Acris Antibodies GmbH
Material safety datasheet MSDS for Proteins (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9R0C2
Purity >95.0% as determined by both RP-HPLC andSDS-PAGE analysis
Background

Tropic 1808 is a candidate chemotropic factor induced by nerve injury. Tpc1808 protein, similar to NGF, could promote the expression of NF-H in a time-dependent manner. Tpc1808 is the gene related to promotion of nerve growth, and both the Tpc1808 gene and the Tpc1808 recombinant protein up-regulate the expression of NF-H in PC12 cells.

Storage Prior to reconstitution store at 2-8°C for one month or desiccated below -18°C.
Following reconstitution store undiluted at 2-8°C for one month
or (in aliquots) at -20°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Description
Description:
Tropic-1808 Human Recombinant protein fused to N-terminal His-Tag produced in E.coli is a single, non-glycosylated polypeptide chain containing 285 amino acids and purified by proprietary chromatographic techniques.
AA Sequence:

MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPS
AGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKL
TIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLS
LNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLS
AAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNF
NLYLIKVKNTWKLMTLLLS.
Format
Buffer System:
1X PBS, pH 7.4
Purity:
>95.0% as determined by both RP-HPLC andSDS-PAGE analysis
State:
Sterile Filtered White lyophilized (freeze-dried) powder
Purified
  • LinkedIn