discontinued

P4981 trxA (Escherichia coli)

Search for all "trxA (Escherichia coli)"

Quick Overview

trxA (Escherichia coli)

P4981

Product Description for trxA (Escherichia coli)

trxA (Escherichia coli).

Properties for trxA (Escherichia coli)

Product Category Proteins & Growth Factors
Quantity 50 µg
Synonyms -
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
B1X9Z5
Add. information 15% SDS-PAGE Stained with Coomassie Blue
Escherichia coli
Application Func, SDS-PAGE
Concentration 0.5 mg/mL
Storage Store at -20°C. For long term storage store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MHHHHHHMGSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTA PKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGS
Format
Buffer System:
In 20 mM Tris-HCl, pH 8.0 (1 mM DTT, 10% glycerol).
State:
Liquid
  • LinkedIn