P3424 TSTD1

Search for all "TSTD1"

50 µg / €380.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

TSTD1

P3424

Product Description for TSTD1

TSTD1.

Properties for TSTD1

Product Category Proteins & Growth Factors
Quantity 50 µg
Synonyms LOC100131187
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NFU3
Add. information Loading 3 ug protein in 15% SDS-PAGE
Escherichia coli
Application SDS-PAGE
Concentration 1.0 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMAGAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEP AAFQALYSAEKPKLEDEHLVFFCQMGKRGLQATQLARSLGYTGARNYAGAYREWLEKES
Format
Buffer System:
In 20 mM Tris-HCl, 100 mM NaCl, pH 8.0 (1 mM dithiothreitol, 10% glycerol).
State:
Liquid
  • LinkedIn