discontinued

P3424 TSTD1

Search for all "TSTD1"

Quick Overview

TSTD1

P3424

Product Description for TSTD1

TSTD1.

Properties for TSTD1

Product Category Proteins & Growth Factors
Quantity 50 µg
Synonyms LOC100131187
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NFU3
Add. information Loading 3 ug protein in 15% SDS-PAGE
Escherichia coli
Application SDS-PAGE
Concentration 1.0 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMAGAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEP AAFQALYSAEKPKLEDEHLVFFCQMGKRGLQATQLARSLGYTGARNYAGAYREWLEKES
Format
Buffer System:
In 20 mM Tris-HCl, 100 mM NaCl, pH 8.0 (1 mM dithiothreitol, 10% glycerol).
State:
Liquid
  • LinkedIn