discontinued

AR10699PU-L West Nile Virus Pre-M

Search for all "West Nile Virus Pre-M"

1 mg / €1,210.00

Quick Overview

West Nile Virus Pre-M

AR10699PU-L

Product Description for West Nile Virus Pre-M

West Nile Virus Pre-M.
Presentation: Purified

Properties for West Nile Virus Pre-M

Product Category Proteins & Growth Factors
Quantity 1 mg
Presentation Purified
Source E. coli
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Acris Antibodies GmbH
Material safety datasheet MSDS for Proteins (de)

Datasheet Extract

Purity >95.0% pure as determined by 10.0% PAGE (coomassie staining). 
Purification Method: Purified by proprietary chromatographic technique.
Application Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems.
Background

West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopyreveal a 45-50 nm virion covered with a relatively smooth proteinsurface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDaprotein blocks; the capsid is contained within a host-derived membrane altered by two viral glycoproteins.

Storage

Store undiluted at 2-8°C for one month or (in aliquots) at -20°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.

Description
Description:
The E.coli derived 20 kDa recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions.
The protein is fused with 6xHis tag. 
Specificity: Immunoreactive with sera of West Nile virus infected individuals.
AA Sequence:
MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA.
MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVR.
YGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTK.
ATRYLVKTESWILRNPGYALE
Format
Buffer System:
20mM Phosphate buffer pH 7.5
Purity:
>95.0% pure as determined by 10.0% PAGE (coomassie staining). 
Purification Method: Purified by proprietary chromatographic technique.
State:
Purified
  • LinkedIn