discontinued

AR10699PU-N West Nile Virus Pre-M

Search for all "West Nile Virus Pre-M"

0.5 mg / €660.00

Quick Overview

West Nile Virus Pre-M

AR10699PU-N

Product Description for West Nile Virus Pre-M

West Nile Virus Pre-M.
Presentation: Purified

Properties for West Nile Virus Pre-M

Product Category Proteins & Growth Factors
Quantity 0.5 mg
Presentation Purified
Source E. coli
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Acris Antibodies GmbH
Material safety datasheet MSDS for Proteins (de)

Datasheet Extract

Purity >95.0% pure as determined by 10.0% PAGE (coomassie staining). 
Purification Method: Purified by proprietary chromatographic technique.
Application Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems.
Background

West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopyreveal a 45-50 nm virion covered with a relatively smooth proteinsurface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDaprotein blocks; the capsid is contained within a host-derived membrane altered by two viral glycoproteins.

Storage

Store undiluted at 2-8°C for one month or (in aliquots) at -20°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.

Description
Description:
The E.coli derived 20 kDa recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions.
The protein is fused with 6xHis tag. 
Specificity: Immunoreactive with sera of West Nile virus infected individuals.
AA Sequence:
MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA.
MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVR.
YGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTK.
ATRYLVKTESWILRNPGYALE
Format
Buffer System:
20mM Phosphate buffer pH 7.5
Purity:
>95.0% pure as determined by 10.0% PAGE (coomassie staining). 
Purification Method: Purified by proprietary chromatographic technique.
State:
Purified
  • LinkedIn