CCP1166-1mg CRF, Human, Rat

Search for all "CRF, Human, Rat"

1 mg / €390.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Properties for CRF, Human, Rat

Product Category Synthetic Peptides
Quantity 1 mg
Molecular weight 4575.5
Source Synthetic
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Cohesion Biosciences Ltd.

Datasheet Extract

Purity > 95 %
Background CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRF plays an important role in the endocrine behavioral and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine feline murine and porcine CRF.
Storage Shipped at 4°C. Store at -20°C for one year.
Peptide to CRF, Human, Rat
CAS Number: 86784-80-7
Molecular Formula: C208H344N60O63S2
Chemical Structure: H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2
Lyophilized powder
  • LinkedIn